Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries) |
Domain d6tl9a1: 6tl9 A:143-270 [391997] Other proteins in same PDB: d6tl9a2, d6tl9b2, d6tl9c2, d6tl9d2, d6tl9e2, d6tl9f2, d6tl9g2, d6tl9h2 automated match to d1ypob_ complexed with gol, njt |
PDB Entry: 6tl9 (more details), 2.73 Å
SCOPe Domain Sequences for d6tl9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tl9a1 d.169.1.0 (A:143-270) automated matches {Human (Homo sapiens) [TaxId: 9606]} pcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfpf wmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaafs icqkkanl
Timeline for d6tl9a1: