SCOPe 2.07: Domain d6tjwe1: 6tjw E:2-318

Lineage for d6tjwe1 (6tjw E:2-318)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [391916] (10 PDB entries)

8. Domain d6tjwe1: 6tjw E:2-318 [391983]
   Other proteins in same PDB: d6tjwb_, d6tjwd_, d6tjwe2, d6tjwf_
   automated match to d3ztna_
   complexed with ca, edo, nag; mutant

Details for d6tjwe1

PDB Entry: 6tjw, 2.31 Å

PDB Description: crystal structure of the haemagglutinin mutant (gln226leu, del228) from an h10n7 seal influenza virus isolated in germany

PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d6tjwe1:

Sequence; same for both SEQRES and ATOM records:

>d6tjwe1 b.19.1.0 (E:2-318) automated matches {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]}
dkiclghhavangtivktltneqeevtnatetvestslnrlcmkgrnhkdlgnchpigml
igtpacdlhltgtwdtlierknaiaycypgatvneealrqkimesggiskintgftygss
insagttkacmrnggnsfyaelkwlvsknkgqnfpqttntyrnadtaehlimwgihhpss
tqekndlygtqslsisvgsstyknnfvpvvgarpqvnglsridfhwtlvqpgdkitfshn
ggliapsrvskligrglgiqseapidnsceskcfwrggsintrlpfqnlsprtvgqcpky
vnkkslmlatgmrnvpe

Timeline for d6tjwe1:

• d6tjwe1 is new in SCOPe 2.07-stable
  
• d6tjwe1 appears in the current release, SCOPe 2.08