Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (57 species) not a true protein |
Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [391916] (10 PDB entries) |
Domain d6tjyc1: 6tjy C:1-318 [391976] Other proteins in same PDB: d6tjya2, d6tjyb_, d6tjyc2, d6tjyd_, d6tjye2, d6tjyf_, d6tjyg2, d6tjyh_, d6tjyi2, d6tjyj_, d6tjyk2, d6tjyl_ automated match to d3ztna_ complexed with ca, nag |
PDB Entry: 6tjy (more details), 2.82 Å
SCOPe Domain Sequences for d6tjyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tjyc1 b.19.1.0 (C:1-318) automated matches {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]} dkiclghhavangtivktltneqeevtnatetvestslnrlcmkgrnhkdlgnchpigml igtpacdlhltgtwdtlierknaiaycypgatvneealrqkimesggiskintgftygss insagttkacmrnggnsfyaelkwlvsknkgqnfpqttntyrnadtaehlimwgihhpss tqekndlygtqslsisvgsstyknnfvpvvgarpqvngqsgridfhwtlvqpgdkitfsh nggliapsrvskligrglgiqseapidnsceskcfwrggsintrlpfqnlsprtvgqcpk yvnkkslmlatgmrnvpe
Timeline for d6tjyc1: