Lineage for d6tjyc1 (6tjy C:1-318)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2385962Species Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId:1572188] [391916] (10 PDB entries)
  8. 2385994Domain d6tjyc1: 6tjy C:1-318 [391976]
    Other proteins in same PDB: d6tjya2, d6tjyb_, d6tjyc2, d6tjyd_, d6tjye2, d6tjyf_, d6tjyg2, d6tjyh_, d6tjyi2, d6tjyj_, d6tjyk2, d6tjyl_
    automated match to d3ztna_
    complexed with ca, nag

Details for d6tjyc1

PDB Entry: 6tjy (more details), 2.82 Å

PDB Description: crystal structure of haemagglutinin from (a/seal/germany/1/2014) seal h10n7 influenza virus
PDB Compounds: (C:) hemagglutinin HA1

SCOPe Domain Sequences for d6tjyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tjyc1 b.19.1.0 (C:1-318) automated matches {Influenza a virus (a/harbour seal/germany/1/2014(h10n7)) [TaxId: 1572188]}
dkiclghhavangtivktltneqeevtnatetvestslnrlcmkgrnhkdlgnchpigml
igtpacdlhltgtwdtlierknaiaycypgatvneealrqkimesggiskintgftygss
insagttkacmrnggnsfyaelkwlvsknkgqnfpqttntyrnadtaehlimwgihhpss
tqekndlygtqslsisvgsstyknnfvpvvgarpqvngqsgridfhwtlvqpgdkitfsh
nggliapsrvskligrglgiqseapidnsceskcfwrggsintrlpfqnlsprtvgqcpk
yvnkkslmlatgmrnvpe

SCOPe Domain Coordinates for d6tjyc1:

Click to download the PDB-style file with coordinates for d6tjyc1.
(The format of our PDB-style files is described here.)

Timeline for d6tjyc1: