Lineage for d6tlcc_ (6tlc C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2359497Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2359498Protein automated matches [190976] (4 species)
    not a true protein
  7. 2359522Species Human (Homo sapiens) [TaxId:9606] [188649] (65 PDB entries)
  8. 3091908Domain d6tlcc_: 6tlc C: [391970]
    Other proteins in same PDB: d6tlca1, d6tlca2, d6tlca3, d6tlcb1, d6tlcb2, d6tlcb3
    automated match to d3uyod_

Details for d6tlcc_

PDB Entry: 6tlc (more details), 2.9 Å

PDB Description: unphosphorylated human stat3 in complex with ms3-6 monobody
PDB Compounds: (C:) monobody

SCOPe Domain Sequences for d6tlcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tlcc_ b.1.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsvssvptklevvaatptslliswdapavtvdfyhitygetggnspvqeftvpgskstat
isglkpgvdytitvyayvsypeyyfpspisinyrt

SCOPe Domain Coordinates for d6tlcc_:

Click to download the PDB-style file with coordinates for d6tlcc_.
(The format of our PDB-style files is described here.)

Timeline for d6tlcc_:

  • d6tlcc_ is new in SCOPe 2.07-stable