SCOP 1.65: Domain d1cvjd1: 1cvj D:11-90

Lineage for d1cvjd1 (1cvj D:11-90)

Root: SCOP 1.65
Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families)
Family d.58.7.1: Canonical RBD [54929] (16 proteins)
Protein Poly(A)-binding protein [54948] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry)
Domain d1cvjd1: 1cvj D:11-90 [39197]

Details for d1cvjd1

PDB Entry: 1cvj (more details), 2.6 Å

PDB Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna

SCOP Domain Sequences for d1cvjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvjd1 d.58.7.1 (D:11-90) Poly(A)-binding protein {Human (Homo sapiens)}
aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
tmnfdvikgkpvrimwsqrd

SCOP Domain Coordinates for d1cvjd1:

Click to download the PDB-style file with coordinates for d1cvjd1.
(The format of our PDB-style files is described here.)

Timeline for d1cvjd1: