Lineage for d6tlca1 (6tlc A:136-321)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323361Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2323362Superfamily a.47.1: STAT [47655] (2 families) (S)
  5. 3091892Family a.47.1.0: automated matches [391954] (1 protein)
    not a true family
  6. 3091893Protein automated matches [391955] (1 species)
    not a true protein
  7. 3091894Species Homo sapiens [TaxId:9606] [391956] (1 PDB entry)
  8. 3091904Domain d6tlca1: 6tlc A:136-321 [391966]
    Other proteins in same PDB: d6tlca2, d6tlca3, d6tlcb2, d6tlcb3, d6tlcc_, d6tlcd_
    automated match to d1bg1a1

Details for d6tlca1

PDB Entry: 6tlc (more details), 2.9 Å

PDB Description: unphosphorylated human stat3 in complex with ms3-6 monobody
PDB Compounds: (A:) Signal transducer and activator of transcription 3

SCOPe Domain Sequences for d6tlca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tlca1 a.47.1.0 (A:136-321) automated matches {Homo sapiens [TaxId: 9606]}
vvtekqqmleqhlqdvrkrvqdleqkmkvvenlqddfdfnyktlksqgdmqdlngnnqsv
trqkmqqleqmltaldqmrrsivselagllsameyvqktltdeeladwkrrqqiaciggp
pnicldrlenwitslaesqlqtrqqikkleelqqkvsykgdpivqhrpmleerivelfrn
lmksaf

SCOPe Domain Coordinates for d6tlca1:

Click to download the PDB-style file with coordinates for d6tlca1.
(The format of our PDB-style files is described here.)

Timeline for d6tlca1:

  • d6tlca1 is new in SCOPe 2.07-stable