Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (36 species) not a true protein |
Species Toxoplasma gondii [TaxId:5811] [339885] (3 PDB entries) |
Domain d6tj6b1: 6tj6 B:79-210 [391964] Other proteins in same PDB: d6tj6b2 automated match to d4aqrb_ complexed with imd |
PDB Entry: 6tj6 (more details), 2 Å
SCOPe Domain Sequences for d6tj6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tj6b1 a.39.1.0 (B:79-210) automated matches {Toxoplasma gondii [TaxId: 5811]} eademyarfnarasggkvstgdamilarqlglapsyadkqafeeksgdnldyasfqkfvg tsthpedniedlveafayfdvskhgyltrkqmgnilmtygepltteefnalaaeyftsdq idyrqfckamle
Timeline for d6tj6b1: