Lineage for d6tlcb3 (6tlc B:576-688)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965705Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2965706Protein automated matches [190561] (4 species)
    not a true protein
  7. 2965707Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)
  8. 2965855Domain d6tlcb3: 6tlc B:576-688 [391961]
    Other proteins in same PDB: d6tlca1, d6tlca2, d6tlcb1, d6tlcb2, d6tlcc_, d6tlcd_
    automated match to d1bg1a3

Details for d6tlcb3

PDB Entry: 6tlc (more details), 2.9 Å

PDB Description: unphosphorylated human stat3 in complex with ms3-6 monobody
PDB Compounds: (B:) Signal transducer and activator of transcription 3

SCOPe Domain Sequences for d6tlcb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tlcb3 d.93.1.0 (B:576-688) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilalwnegyimgfiskererailstkppgtfllrfsesskeggvtftwvekdisgktqiq
svepytkqqlnnmsfaeiimgykimdatnilvsplvylypdipkeeafgkycr

SCOPe Domain Coordinates for d6tlcb3:

Click to download the PDB-style file with coordinates for d6tlcb3.
(The format of our PDB-style files is described here.)

Timeline for d6tlcb3: