Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
Protein automated matches [190561] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries) |
Domain d6tlcb3: 6tlc B:576-688 [391961] Other proteins in same PDB: d6tlca1, d6tlca2, d6tlcb1, d6tlcb2, d6tlcc_, d6tlcd_ automated match to d1bg1a3 |
PDB Entry: 6tlc (more details), 2.9 Å
SCOPe Domain Sequences for d6tlcb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tlcb3 d.93.1.0 (B:576-688) automated matches {Human (Homo sapiens) [TaxId: 9606]} ilalwnegyimgfiskererailstkppgtfllrfsesskeggvtftwvekdisgktqiq svepytkqqlnnmsfaeiimgykimdatnilvsplvylypdipkeeafgkycr
Timeline for d6tlcb3: