Lineage for d6tlcb2 (6tlc B:322-575)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2363595Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2364216Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2364569Family b.2.5.5: STAT DNA-binding domain [81317] (4 proteins)
  6. 3091896Protein automated matches [391958] (1 species)
    not a true protein
  7. 3091897Species Homo sapiens [TaxId:9606] [391959] (1 PDB entry)
  8. 3091898Domain d6tlcb2: 6tlc B:322-575 [391960]
    Other proteins in same PDB: d6tlca1, d6tlca3, d6tlcb1, d6tlcb3, d6tlcc_, d6tlcd_
    automated match to d1bg1a2

Details for d6tlcb2

PDB Entry: 6tlc (more details), 2.9 Å

PDB Description: unphosphorylated human stat3 in complex with ms3-6 monobody
PDB Compounds: (B:) Signal transducer and activator of transcription 3

SCOPe Domain Sequences for d6tlcb2:

Sequence, based on SEQRES records: (download)

>d6tlcb2 b.2.5.5 (B:322-575) automated matches {Homo sapiens [TaxId: 9606]}
vverqpcmpmhpdrplviktgvqfttkvrllvkfpelnyqlkikvcidkdsgdvaalrgs
rkfnilgtntkvmnmeesnngslsaefkhltlreqrcgnggrancdaslivteelhlitf
etevyhqglkidlethslpvvvisnicqmpnawasilwynmltnnpknvnfftkppigtw
dqvaevlswqfssttkrglsieqlttlaekllgpgvnysgcqitwakfckenmagkgfsf
wvwldniidlvkky

Sequence, based on observed residues (ATOM records): (download)

>d6tlcb2 b.2.5.5 (B:322-575) automated matches {Homo sapiens [TaxId: 9606]}
vverqpcmpmhpdrplviktgvqfttkvrllvkfpelnyqlkikvcidkdrgsrkfnilg
tntkvmnmeesnngslsaefkhltlreqrcgslivteelhlitfetevyhqglkidleth
slpvvvisnicqmpnawasilwynmltnnpknvnfftkppigtwdqvaevlswqfssttk
rglsieqlttlaekllgpgvnysgcqitwakfckenmagkgfsfwvwldniidlvkky

SCOPe Domain Coordinates for d6tlcb2:

Click to download the PDB-style file with coordinates for d6tlcb2.
(The format of our PDB-style files is described here.)

Timeline for d6tlcb2:

  • d6tlcb2 is new in SCOPe 2.07-stable