SCOPe 2.08: Domain d6ti9b_: 6ti9 B:

Lineage for d6ti9b_ (6ti9 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
   Uniprot P02766 31-143

8. Domain d6ti9b_: 6ti9 B: [391950]
   automated match to d1ttaa_
   complexed with gol, nd5, pgo

Details for d6ti9b_

PDB Entry: 6ti9, 1.45 Å

PDB Description: human transthyretin (ttr) complexed with (e)-3-(((3,5-dibromo-2- hydroxybenzylidene)amino)oxy)propanoic acid.

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d6ti9b_:

Sequence; same for both SEQRES and ATOM records:

>d6ti9b_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Timeline for d6ti9b_:

• d6ti9b_ first appeared in SCOPe 2.07