SCOPe 2.08: Domain d1cvjc1: 1cvj C:11-90

Lineage for d1cvjc1 (1cvj C:11-90)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)
Family d.58.7.1: Canonical RBD [54929] (70 proteins)
Pfam PF00076
Pfam PF13893
Protein Poly(A)-binding protein [54948] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry)
Domain d1cvjc1: 1cvj C:11-90 [39195]
protein/RNA complex; complexed with a

Details for d1cvjc1

PDB Entry: 1cvj (more details), 2.6 Å

PDB Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna

PDB Compounds: (C:) polyadenylate binding protein 1

SCOPe Domain Sequences for d1cvjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvjc1 d.58.7.1 (C:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}
aslyvgdlhpdvteamlyekfspagpilsirvcrdmitrrslgyayvnfqqpadaerald
tmnfdvikgkpvrimwsqrd

SCOPe Domain Coordinates for d1cvjc1:

Click to download the PDB-style file with coordinates for d1cvjc1.
(The format of our PDB-style files is described here.)

Timeline for d1cvjc1: