SCOPe 2.07: Domain d6tj5b1: 6tj5 B:77-210

Lineage for d6tj5b1 (6tj5 B:77-210)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:5811] [339885] (3 PDB entries)

8. Domain d6tj5b1: 6tj5 B:77-210 [391936]
   Other proteins in same PDB: d6tj5b2
   automated match to d4aqrb_
   complexed with ca, cl

Details for d6tj5b1

PDB Entry: 6tj5, 2.39 Å

PDB Description: t. gondii myosin a trimeric complex with elc1

PDB Compounds: (B:) Myosin light chain TgMLC1

SCOPe Domain Sequences for d6tj5b1:

Sequence; same for both SEQRES and ATOM records:

>d6tj5b1 a.39.1.0 (B:77-210) automated matches {Toxoplasma gondii [TaxId: 5811]}
mveademyarfnarasggkvstgdamilarqlglapsyadkqafeeksgdnldyasfqkf
vgtsthpedniedlveafayfdvskhgyltrkqmgnilmtygepltteefnalaaeyfts
dqidyrqfckamle

Timeline for d6tj5b1:

• d6tj5b1 is new in SCOPe 2.07-stable
  
• d6tj5b1 appears in the current release, SCOPe 2.08