Lineage for d1cvja2 (1cvj A:91-179)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329138Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 329139Family d.58.7.1: Canonical RBD [54929] (16 proteins)
  6. 329198Protein Poly(A)-binding protein [54948] (1 species)
  7. 329199Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry)
  8. 329201Domain d1cvja2: 1cvj A:91-179 [39192]

Details for d1cvja2

PDB Entry: 1cvj (more details), 2.6 Å

PDB Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna

SCOP Domain Sequences for d1cvja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens)}
pslrksgvgnifiknldksidnkalydtfsafgnilsckvvcdengskgygfvhfetqea
aeraiekmngmllndrkvfvgrfksrker

SCOP Domain Coordinates for d1cvja2:

Click to download the PDB-style file with coordinates for d1cvja2.
(The format of our PDB-style files is described here.)

Timeline for d1cvja2: