SCOP 1.55: Domain d1cvja2: 1cvj A:91-179

Lineage for d1cvja2 (1cvj A:91-179)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families)

5. Family d.58.7.1: Canonical RBD [54929] (12 proteins)

6. Protein Poly(A)-binding protein [54948] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54949] (1 PDB entry)

8. Domain d1cvja2: 1cvj A:91-179 [39192]

Details for d1cvja2

PDB Entry: 1cvj, 2.6 Å

PDB Description: x-ray crystal structure of the poly(a)-binding protein in complex with polyadenylate rna

SCOP Domain Sequences for d1cvja2:

Sequence; same for both SEQRES and ATOM records:

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens)}
pslrksgvgnifiknldksidnkalydtfsafgnilsckvvcdengskgygfvhfetqea
aeraiekmngmllndrkvfvgrfksrker

Timeline for d1cvja2:

• d1cvja2 appears in SCOP 1.57
  
• d1cvja2 appears in the current release, SCOPe 2.08