SCOPe 2.07: Domain d6tc6a2: 6tc6 A:136-218

Lineage for d6tc6a2 (6tc6 A:136-218)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (4 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.0: automated matches [254300] (1 protein)
   not a true family

6. Protein automated matches [254693] (4 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:996307] [391909] (1 PDB entry)

8. Domain d6tc6a2: 6tc6 A:136-218 [391910]
   Other proteins in same PDB: d6tc6a1, d6tc6a3, d6tc6c1, d6tc6c3
   automated match to d1r2za1
   complexed with zn

Details for d6tc6a2

PDB Entry: 6tc6, 2.9 Å

PDB Description: crystal structure of mutm from neisseria meningitidis

PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d6tc6a2:

Sequence; same for both SEQRES and ATOM records:

>d6tc6a2 a.156.1.0 (A:136-218) automated matches {Neisseria meningitidis [TaxId: 996307]}
gpeplseafcadylyarlkaqkravklalmdnavvvgvgniyaneslfragisphrpanr
lkkkecallvetvkavlqraiet

Timeline for d6tc6a2:

• d6tc6a2 is new in SCOPe 2.07-stable
  
• d6tc6a2 appears in the current release, SCOPe 2.08