Class a: All alpha proteins [46456] (289 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.0: automated matches [254300] (1 protein) not a true family |
Protein automated matches [254693] (4 species) not a true protein |
Species Neisseria meningitidis [TaxId:996307] [391909] (1 PDB entry) |
Domain d6tc6a2: 6tc6 A:136-218 [391910] Other proteins in same PDB: d6tc6a1, d6tc6a3, d6tc6c1, d6tc6c3 automated match to d1r2za1 complexed with zn |
PDB Entry: 6tc6 (more details), 2.9 Å
SCOPe Domain Sequences for d6tc6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tc6a2 a.156.1.0 (A:136-218) automated matches {Neisseria meningitidis [TaxId: 996307]} gpeplseafcadylyarlkaqkravklalmdnavvvgvgniyaneslfragisphrpanr lkkkecallvetvkavlqraiet
Timeline for d6tc6a2: