SCOPe 2.07: Domain d6tc6a1: 6tc6 A:2-135

Lineage for d6tc6a1 (6tc6 A:2-135)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families)
   automatically mapped to Pfam PF01149

5. Family b.113.1.0: automated matches [391905] (1 protein)
   not a true family

6. Protein automated matches [391906] (1 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:996307] [391907] (1 PDB entry)

8. Domain d6tc6a1: 6tc6 A:2-135 [391908]
   Other proteins in same PDB: d6tc6a2, d6tc6a3, d6tc6c2, d6tc6c3
   automated match to d3gq4a1
   complexed with zn

Details for d6tc6a1

PDB Entry: 6tc6, 2.9 Å

PDB Description: crystal structure of mutm from neisseria meningitidis

PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d6tc6a1:

Sequence; same for both SEQRES and ATOM records:

>d6tc6a1 b.113.1.0 (A:2-135) automated matches {Neisseria meningitidis [TaxId: 996307]}
pelpevettlrgiaphiegktveavvlrqlklrwqinpdlgeilsgrqvlscgrrakyll
irfqtgvllihlgmsgslriftpsdgrigrpdrhdhvdivfsdgtvmryrdprkfgailw
yegieehhpllekl

Timeline for d6tc6a1:

• d6tc6a1 is new in SCOPe 2.07-stable
  
• d6tc6a1 appears in the current release, SCOPe 2.08