Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (4 families) also contains 8-bladed propellers |
Family b.69.4.0: automated matches [191412] (1 protein) not a true family |
Protein automated matches [190568] (11 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [391841] (2 PDB entries) |
Domain d6tble_: 6tbl E: [391897] Other proteins in same PDB: d6tblf2 automated match to d3j3ag_ complexed with edo, k |
PDB Entry: 6tbl (more details), 2.65 Å
SCOPe Domain Sequences for d6tble_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tble_ b.69.4.0 (E:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} grlilehtlqghkgriwgvawhpkgnvfascgedkairiwsltgntwstktilsdghkrt ireirwspcgqylasasfdattaiwskssgefecnatleghenevksvswsrsggllatc srdksvwiwevagddefecaavlnphtqdvkrvvwhptkdilasasydntikmfaeepid ndwdctatltshtstvwgidfdadgerlvscsddttikiwrayhpgntagvatpdqqtvw kcvctvsgqhsraiydvswckltgliatacgddgirifkessdskpdeptfeqitaeega hdqdvnsvqwnpvvagqliscsddgtikiwkvte
Timeline for d6tble_: