Lineage for d6tble_ (6tbl E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2809156Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2809157Protein automated matches [190568] (11 species)
    not a true protein
  7. 2809203Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [391841] (2 PDB entries)
  8. 2809205Domain d6tble_: 6tbl E: [391897]
    Other proteins in same PDB: d6tblf2
    automated match to d3j3ag_
    complexed with edo, k

Details for d6tble_

PDB Entry: 6tbl (more details), 2.65 Å

PDB Description: crystal structure of mms19(ctd)-ciao1-ciao2b cia targeting complex
PDB Compounds: (E:) Probable cytosolic iron-sulfur protein assembly protein Ciao1

SCOPe Domain Sequences for d6tble_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tble_ b.69.4.0 (E:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
grlilehtlqghkgriwgvawhpkgnvfascgedkairiwsltgntwstktilsdghkrt
ireirwspcgqylasasfdattaiwskssgefecnatleghenevksvswsrsggllatc
srdksvwiwevagddefecaavlnphtqdvkrvvwhptkdilasasydntikmfaeepid
ndwdctatltshtstvwgidfdadgerlvscsddttikiwrayhpgntagvatpdqqtvw
kcvctvsgqhsraiydvswckltgliatacgddgirifkessdskpdeptfeqitaeega
hdqdvnsvqwnpvvagqliscsddgtikiwkvte

SCOPe Domain Coordinates for d6tble_:

Click to download the PDB-style file with coordinates for d6tble_.
(The format of our PDB-style files is described here.)

Timeline for d6tble_: