Lineage for d6swhb_ (6swh B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767842Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2767843Protein automated matches [190503] (10 species)
    not a true protein
  7. 2767888Species Escherichia coli [TaxId:83333] [346217] (8 PDB entries)
  8. 2767895Domain d6swhb_: 6swh B: [391892]
    Other proteins in same PDB: d6swha1, d6swha2, d6swhd1, d6swhd2
    automated match to d5lp9a_
    complexed with edo, peg

Details for d6swhb_

PDB Entry: 6swh (more details), 2.8 Å

PDB Description: crystal structure of the ternary complex between the type 1 pilus proteins fimc, fimi and fima from e. coli
PDB Compounds: (B:) Fimbrin-like protein FimI

SCOPe Domain Sequences for d6swhb_:

Sequence, based on SEQRES records: (download)

>d6swhb_ b.2.3.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
gnmqfqgviiaetcrieagdkqmtvnmgqissnrfhavgedsapvpfvihlrecstvvse
rvgvafhgvadgknpdvlsvgegpgiatnigvalfddegnlvpinrppanwkrlysgsts
lhfiakyratgrrvtggianaqawfsltyq

Sequence, based on observed residues (ATOM records): (download)

>d6swhb_ b.2.3.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
gnmqfqgviiaetcrieagdkqmtvnmgqissnrfhavgedsapvpfvihlrecstvvse
rvgvafhgvadgknpdvlsvgegpgiatnigvalfddegnlvpinrppanwkrgstslhf
iakyratgrrvtggianaqawfsltyq

SCOPe Domain Coordinates for d6swhb_:

Click to download the PDB-style file with coordinates for d6swhb_.
(The format of our PDB-style files is described here.)

Timeline for d6swhb_: