Lineage for d2msta_ (2mst A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195166Protein Neural RNA-binding protein Musashi-1 [54946] (1 species)
  7. 2195167Species Mouse (Mus musculus) [TaxId:10090] [54947] (2 PDB entries)
  8. 2195168Domain d2msta_: 2mst A: [39189]
    RBD2

Details for d2msta_

PDB Entry: 2mst (more details)

PDB Description: musashi1 rbd2, nmr
PDB Compounds: (A:) protein (musashi1)

SCOPe Domain Sequences for d2msta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}
kifvgglsvnttvedvkhyfeqfgkvddamlmfdkttnrhrgfgfvtfesedivekvcei
hfheinnkmveckka

SCOPe Domain Coordinates for d2msta_:

Click to download the PDB-style file with coordinates for d2msta_.
(The format of our PDB-style files is described here.)

Timeline for d2msta_: