Lineage for d2msta_ (2mst A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329138Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 329139Family d.58.7.1: Canonical RBD [54929] (16 proteins)
  6. 329175Protein Neural RNA-binding protein Musashi-1 [54946] (1 species)
  7. 329176Species Mouse (Mus musculus) [TaxId:10090] [54947] (2 PDB entries)
  8. 329177Domain d2msta_: 2mst A: [39189]
    RBD2

Details for d2msta_

PDB Entry: 2mst (more details)

PDB Description: musashi1 rbd2, nmr

SCOP Domain Sequences for d2msta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus)}
kifvgglsvnttvedvkhyfeqfgkvddamlmfdkttnrhrgfgfvtfesedivekvcei
hfheinnkmveckka

SCOP Domain Coordinates for d2msta_:

Click to download the PDB-style file with coordinates for d2msta_.
(The format of our PDB-style files is described here.)

Timeline for d2msta_: