Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) |
Family d.58.7.1: Canonical RBD [54929] (16 proteins) |
Protein Neural RNA-binding protein Musashi-1 [54946] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [54947] (2 PDB entries) |
Domain d2msta_: 2mst A: [39189] RBD2 |
PDB Entry: 2mst (more details)
SCOP Domain Sequences for d2msta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus)} kifvgglsvnttvedvkhyfeqfgkvddamlmfdkttnrhrgfgfvtfesedivekvcei hfheinnkmveckka
Timeline for d2msta_: