SCOPe 2.07: Domain d6tded2: 6tde D:246-441

Lineage for d6tded2 (6tde D:246-441)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [226224] (26 PDB entries)

8. Domain d6tded2: 6tde D:246-441 [391884]
   Other proteins in same PDB: d6tdea1, d6tdeb1, d6tdec1, d6tded1, d6tdee1, d6tdee2
   automated match to d3rycd2
   complexed with gdp, gtp, mg, n3z, so4

Details for d6tded2

PDB Entry: 6tde, 2.29 Å

PDB Description: tubulin-inhibitor complex

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d6tded2:

Sequence, based on SEQRES records:

>d6tded2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records):

>d6tded2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqaltvpeltqqmfdsknmmaacdp
rhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsa
tfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqy
qdatad

Timeline for d6tded2:

• d6tded2 is new in SCOPe 2.07-stable
  
• d6tded2 appears in the current release, SCOPe 2.08