![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (44 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (14 proteins) |
![]() | Protein Hu antigen D (Hud) [54942] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54943] (2 PDB entries) |
![]() | Domain d1g2ea1: 1g2e A:37-118 [39185] |
PDB Entry: 1g2e (more details), 2.3 Å
SCOP Domain Sequences for d1g2ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2ea1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens)} sktnlivnylpqnmtqeefrslfgsigeiescklvrdkitgqslgygfvnyidpkdaeka intlnglrlqtktikvsyarps
Timeline for d1g2ea1: