Lineage for d1g2ea1 (1g2e A:37-118)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) 
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) 
Family d.58.7.1: Canonical RBD [54929] (14 proteins) 
Protein Hu antigen D (Hud) [54942] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54943] (2 PDB entries) 
Domain d1g2ea1: 1g2e A:37-118 [39185]
Details for d1g2ea1
PDB Entry: 1g2e (more details), 2.3 Å
PDB Description: crystal structure of hud and au-rich element of the tumor necrosis factor alpha rna
SCOP Domain Sequences for d1g2ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2ea1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens)}
sktnlivnylpqnmtqeefrslfgsigeiescklvrdkitgqslgygfvnyidpkdaeka
intlnglrlqtktikvsyarps
SCOP Domain Coordinates for d1g2ea1:
Click to download the PDB-style file with coordinates for d1g2ea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g2ea1:
- d1g2ea1 first appeared (with stable ids) in SCOP 1.55
- d1g2ea1 appears in SCOP 1.59
- d1g2ea1 appears in SCOP 1.63
- d1g2ea1 appears in the current release, SCOPe 2.08
View in 3D
