SCOPe 2.08: Domain d6tbnb1: 6tbn B:2-335

Lineage for d6tbnb1 (6tbn B:2-335)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.0: automated matches [191412] (1 protein)
   not a true family

6. Protein automated matches [190568] (10 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [391841] (2 PDB entries)

8. Domain d6tbnb1: 6tbn B:2-335 [391842]
   Other proteins in same PDB: d6tbnb2
   automated match to d3j3ag_
   complexed with na

Details for d6tbnb1

PDB Entry: 6tbn, 2 Å

PDB Description: crystal structure of ciao1-ciao2b cia core complex

PDB Compounds: (B:) Probable cytosolic iron-sulfur protein assembly protein Ciao1

SCOPe Domain Sequences for d6tbnb1:

Sequence; same for both SEQRES and ATOM records:

>d6tbnb1 b.69.4.0 (B:2-335) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
grlilehtlqghkgriwgvawhpkgnvfascgedkairiwsltgntwstktilsdghkrt
ireirwspcgqylasasfdattaiwskssgefecnatleghenevksvswsrsggllatc
srdksvwiwevagddefecaavlnphtqdvkrvvwhptkdilasasydntikmfaeepid
ndwdctatltshtstvwgidfdadgerlvscsddttikiwrayhpgntagvatpdqqtvw
kcvctvsgqhsraiydvswckltgliatacgddgirifkessdskpdeptfeqitaeega
hdqdvnsvqwnpvvagqliscsddgtikiwkvte

Timeline for d6tbnb1:

• d6tbnb1 first appeared in SCOPe 2.07