Lineage for d1fxla2 (1fxl A:119-203)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412350Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 412351Family d.58.7.1: Canonical RBD [54929] (20 proteins)
  6. 412376Protein Hu antigen D (Hud) [54942] (1 species)
  7. 412377Species Human (Homo sapiens) [TaxId:9606] [54943] (2 PDB entries)
  8. 412379Domain d1fxla2: 1fxl A:119-203 [39184]
    protein/RNA complex

Details for d1fxla2

PDB Entry: 1fxl (more details), 1.8 Å

PDB Description: crystal structure of hud and au-rich element of the c-fos rna

SCOP Domain Sequences for d1fxla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens)}
sasirdanlyvsglpktmtqkeleqlfsqygriitsrilvdqvtgvsrgvgfirfdkrie
aeeaikglngqkpsgatepitvkfa

SCOP Domain Coordinates for d1fxla2:

Click to download the PDB-style file with coordinates for d1fxla2.
(The format of our PDB-style files is described here.)

Timeline for d1fxla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fxla1