Lineage for d1fxla1 (1fxl A:37-118)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257431Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 257432Family d.58.7.1: Canonical RBD [54929] (14 proteins)
  6. 257452Protein Hu antigen D (Hud) [54942] (1 species)
  7. 257453Species Human (Homo sapiens) [TaxId:9606] [54943] (2 PDB entries)
  8. 257454Domain d1fxla1: 1fxl A:37-118 [39183]

Details for d1fxla1

PDB Entry: 1fxl (more details), 1.8 Å

PDB Description: crystal structure of hud and au-rich element of the c-fos rna

SCOP Domain Sequences for d1fxla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens)}
sktnlivnylpqnmtqeefrslfgsigeiescklvrdkitgqslgygfvnyidpkdaeka
intlnglrlqtktikvsyarps

SCOP Domain Coordinates for d1fxla1:

Click to download the PDB-style file with coordinates for d1fxla1.
(The format of our PDB-style files is described here.)

Timeline for d1fxla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fxla2