SCOPe 2.08: Domain d6t6ia1: 6t6i A:219-270

Lineage for d6t6ia1 (6t6i A:219-270)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families)

5. Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
   Pfam PF00552, Pfam PF18103

6. Protein DNA-binding domain of retroviral integrase [50124] (4 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50125] (8 PDB entries)

8. Domain d6t6ia1: 6t6i A:219-270 [391827]
   Other proteins in same PDB: d6t6ia2
   automated match to d1c6vx_
   complexed with ni

Details for d6t6ia1

PDB Entry: 6t6i, 2.2 Å

PDB Description: crystal structure of the c-terminal domain of the hiv-1 integrase (subtype a2)

PDB Compounds: (A:) pol protein

SCOPe Domain Sequences for d6t6ia1:

Sequence; same for both SEQRES and ATOM records:

>d6t6ia1 b.34.7.1 (A:219-270) DNA-binding domain of retroviral integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
hiqnfrvyyrdsrdpiwkgpakllwkgegavviqdnsdikvvprrkakiird

Timeline for d6t6ia1:

• d6t6ia1 first appeared in SCOPe 2.07