SCOPe 2.07: Domain d6t6ea1: 6t6e A:219-270

Lineage for d6t6ea1 (6t6e A:219-270)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families)

5. Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (2 proteins)

6. Protein automated matches [347599] (2 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [347600] (4 PDB entries)

8. Domain d6t6ea1: 6t6e A:219-270 [391825]
   Other proteins in same PDB: d6t6ea2
   automated match to d1c6vx_
   complexed with ni

Details for d6t6ea1

PDB Entry: 6t6e, 1.3 Å

PDB Description: crystal structure of the c-terminal domain of the hiv-1 integrase (pnl4-3)

PDB Compounds: (A:) pol protein

SCOPe Domain Sequences for d6t6ea1:

Sequence; same for both SEQRES and ATOM records:

>d6t6ea1 b.34.7.1 (A:219-270) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
hiqnfrvyyrdsrdpvwkgpakllwkgegavviqdnsdikvvprrkakiird

Timeline for d6t6ea1:

• d6t6ea1 is new in SCOPe 2.07-stable
  
• d6t6ea1 appears in the current release, SCOPe 2.08