Lineage for d2sxl__ (2sxl -)
- Root: SCOP 1.65
Class d: Alpha and beta proteins (a+b) [53931] (234 folds) 
Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) 
Family d.58.7.1: Canonical RBD [54929] (16 proteins) 
Protein Sex-lethal protein [54938] (1 species) Species Drosophila melanogaster [TaxId:7227] [54939] (4 PDB entries) 
Domain d2sxl__: 2sxl - [39179]
first RBD
mutant
Details for d2sxl__
PDB Entry: 2sxl (more details)
PDB Description: sex-lethal rbd1, nmr, minimized average structure
SCOP Domain Sequences for d2sxl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sxl__ d.58.7.1 (-) Sex-lethal protein {Drosophila melanogaster}
asntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysygyafvdftsemdsqr
aikvlngitvrnkrlkvsyarpggesik
SCOP Domain Coordinates for d2sxl__:
Click to download the PDB-style file with coordinates for d2sxl__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2sxl__:
- d2sxl__ first appeared (with stable ids) in SCOP 1.55
- d2sxl__ appears in SCOP 1.63
- d2sxl__ appears in SCOP 1.67
- d2sxl__ appears in the current release, SCOPe 2.08, called d2sxla_
View in 3D