SCOP 1.55: Domain d3sxlc2: 3sxl C:206-289

Lineage for d3sxlc2 (3sxl C:206-289)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families)

5. Family d.58.7.1: Canonical RBD [54929] (12 proteins)

6. Protein Sex-lethal protein [54938] (1 species)

7. Species Drosophila melanogaster [TaxId:7227] [54939] (4 PDB entries)

8. Domain d3sxlc2: 3sxl C:206-289 [39178]

Details for d3sxlc2

PDB Entry: 3sxl, 2.7 Å

PDB Description: sex-lethal rna recognition domains 1 and 2 from drosophila melanogaster

SCOP Domain Sequences for d3sxlc2:

Sequence, based on SEQRES records:

>d3sxlc2 d.58.7.1 (C:206-289) Sex-lethal protein {Drosophila melanogaster}
esikdtnlyvtnlprtitddqldtifgkygsivqknilrdkltgrprgvafvrynkreea
qeaisalnnvipeggsqplsvrla

Sequence, based on observed residues (ATOM records):

>d3sxlc2 d.58.7.1 (C:206-289) Sex-lethal protein {Drosophila melanogaster}
esikdtnlyvtnlprtitddqldtifgkygsivqknilrdkltgrprgvafvrynkreea
qeaisalnnvplsvrla

Timeline for d3sxlc2:

• d3sxlc2 appears in SCOP 1.57
  
• d3sxlc2 appears in the current release, SCOPe 2.08