SCOPe 2.07: Domain d6t1ea1: 6t1e A:14-135

Lineage for d6t1ea1 (6t1e A:14-135)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries)

8. Domain d6t1ea1: 6t1e A:14-135 [391761]
   Other proteins in same PDB: d6t1ea2
   automated match to d2bc3b_
   complexed with act, cl, gol, hl9

Details for d6t1ea1

PDB Entry: 6t1e, 1.3 Å

PDB Description: streptavidin variants harbouring an artificial organocatalyst based cofactor

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d6t1ea1:

Sequence; same for both SEQRES and ATOM records:

>d6t1ea1 b.61.1.1 (A:14-135) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesaagkaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgqteangwrstlvghdtftkv
kp

Timeline for d6t1ea1:

• d6t1ea1 is new in SCOPe 2.07-stable
  
• d6t1ea1 appears in the current release, SCOPe 2.08