Lineage for d6sm7d2 (6sm7 D:164-296)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721608Species Escherichia coli [TaxId:562] [391547] (1 PDB entry)
  8. 2721612Domain d6sm7d2: 6sm7 D:164-296 [391760]
    Other proteins in same PDB: d6sm7a1, d6sm7b1, d6sm7c1, d6sm7d1
    automated match to d3pdua2
    complexed with bo3

Details for d6sm7d2

PDB Entry: 6sm7 (more details), 1.88 Å

PDB Description: crystal structure of sla reductase yihu from e. coli
PDB Compounds: (D:) 3-sulfolactaldehyde reductase

SCOPe Domain Sequences for d6sm7d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sm7d2 a.100.1.0 (D:164-296) automated matches {Escherichia coli [TaxId: 562]}
pgmgirvklinnymsialnalsaeaavlcealnlpfdvavkvmsgtaagkghfttswpnk
vlsgdlspafmidlahkdlgialdvanqlhvpmplgaasrevysqaraagrgrqdwsail
eqvrvsagmtakv

SCOPe Domain Coordinates for d6sm7d2:

Click to download the PDB-style file with coordinates for d6sm7d2.
(The format of our PDB-style files is described here.)

Timeline for d6sm7d2: