Class a: All alpha proteins [46456] (290 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Escherichia coli [TaxId:562] [391547] (1 PDB entry) |
Domain d6sm7d2: 6sm7 D:164-296 [391760] Other proteins in same PDB: d6sm7a1, d6sm7b1, d6sm7c1, d6sm7d1 automated match to d3pdua2 complexed with bo3 |
PDB Entry: 6sm7 (more details), 1.88 Å
SCOPe Domain Sequences for d6sm7d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sm7d2 a.100.1.0 (D:164-296) automated matches {Escherichia coli [TaxId: 562]} pgmgirvklinnymsialnalsaeaavlcealnlpfdvavkvmsgtaagkghfttswpnk vlsgdlspafmidlahkdlgialdvanqlhvpmplgaasrevysqaraagrgrqdwsail eqvrvsagmtakv
Timeline for d6sm7d2: