SCOPe 2.08: Domain d6sm7d1: 6sm7 D:2-163

Lineage for d6sm7d1 (6sm7 D:2-163)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187725] (8 PDB entries)

8. Domain d6sm7d1: 6sm7 D:2-163 [391759]
   Other proteins in same PDB: d6sm7a2, d6sm7b2, d6sm7c2, d6sm7d2
   automated match to d3pdua1
   complexed with bo3

Details for d6sm7d1

PDB Entry: 6sm7, 1.88 Å

PDB Description: crystal structure of sla reductase yihu from e. coli

PDB Compounds: (D:) 3-sulfolactaldehyde reductase

SCOPe Domain Sequences for d6sm7d1:

Sequence; same for both SEQRES and ATOM records:

>d6sm7d1 c.2.1.0 (D:2-163) automated matches {Escherichia coli [TaxId: 562]}
aaiafiglgqmgspmasnllqqghqlrvfdvnaeavrhlvdkgatpaanpaqaakdaefi
itmlpngdlvrnvlfgengvceglstdalvidmstihplqtdkliadmqakgfsmmdvpv
grtsanaitgtllllaggtaeqveratpilmamgselinagg

Timeline for d6sm7d1:

• d6sm7d1 first appeared in SCOPe 2.07