Lineage for d6suwy_ (6suw Y:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2705014Species Rhodospirillum rubrum [TaxId:269796] [335612] (2 PDB entries)
  8. 2705039Domain d6suwy_: 6suw Y: [391735]
    Other proteins in same PDB: d6suwa2, d6suwk2, d6suwl2, d6suws2
    automated match to d1zpyg_
    complexed with ca, fe

Details for d6suwy_

PDB Entry: 6suw (more details), 2.66 Å

PDB Description: crystal structure of rhodospirillum rubrum rru_a0973 e31a variant
PDB Compounds: (Y:) Uncharacterized protein

SCOPe Domain Sequences for d6suwy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6suwy_ a.25.1.0 (Y:) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
theplevlkeetvnrhraivsvmaeleavdwydqrvdastdpeltailahnrdeekehaa
mtlewlrrndakwaehlrtylftegpit

SCOPe Domain Coordinates for d6suwy_:

Click to download the PDB-style file with coordinates for d6suwy_.
(The format of our PDB-style files is described here.)

Timeline for d6suwy_: