SCOPe 2.05: Domain d3sxla1: 3sxl A:124-203

Lineage for d3sxla1 (3sxl A:124-203)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Sex-lethal protein [54938] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [54939] (4 PDB entries)

8. Domain d3sxla1: 3sxl A:124-203 [39173]

Details for d3sxla1

PDB Entry: 3sxl, 2.7 Å

PDB Description: sex-lethal rna recognition domains 1 and 2 from drosophila melanogaster

PDB Compounds: (A:) protein (sex-lethal)

SCOPe Domain Sequences for d3sxla1:

Sequence; same for both SEQRES and ATOM records:

>d3sxla1 d.58.7.1 (A:124-203) Sex-lethal protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysfgyafvdftsemdsqrai
kvlngitvrnkrlkvsyarp

Timeline for d3sxla1:

• d3sxla1 first appeared (with stable ids) in SCOP 1.55
  
• d3sxla1 appears in SCOPe 2.04
  
• d3sxla1 appears in SCOPe 2.06
  
• d3sxla1 appears in the current release, SCOPe 2.08