| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.58: Ferredoxin-like [54861] (49 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) ![]() |
| Family d.58.7.1: Canonical RBD [54929] (20 proteins) |
| Protein Sex-lethal protein [54938] (1 species) |
| Species Drosophila melanogaster [TaxId:7227] [54939] (4 PDB entries) |
| Domain d1b7fb2: 1b7f B:205-289 [39172] |
PDB Entry: 1b7f (more details), 2.6 Å
SCOP Domain Sequences for d1b7fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b7fb2 d.58.7.1 (B:205-289) Sex-lethal protein {Drosophila melanogaster}
gesikdtnlyvtnlprtitddqldtifgkygsivqknilrdkltgrprgvafvrynkree
aqeaisalnnvipeggsqplsvrla
Timeline for d1b7fb2: