Lineage for d1b7fb2 (1b7f B:205-289)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504527Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 504528Family d.58.7.1: Canonical RBD [54929] (20 proteins)
  6. 504639Protein Sex-lethal protein [54938] (1 species)
  7. 504640Species Drosophila melanogaster [TaxId:7227] [54939] (4 PDB entries)
  8. 504644Domain d1b7fb2: 1b7f B:205-289 [39172]

Details for d1b7fb2

PDB Entry: 1b7f (more details), 2.6 Å

PDB Description: sxl-lethal protein/rna complex

SCOP Domain Sequences for d1b7fb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7fb2 d.58.7.1 (B:205-289) Sex-lethal protein {Drosophila melanogaster}
gesikdtnlyvtnlprtitddqldtifgkygsivqknilrdkltgrprgvafvrynkree
aqeaisalnnvipeggsqplsvrla

SCOP Domain Coordinates for d1b7fb2:

Click to download the PDB-style file with coordinates for d1b7fb2.
(The format of our PDB-style files is described here.)

Timeline for d1b7fb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b7fb1