Lineage for d6ssca_ (6ssc A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972806Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2972807Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2973039Family d.118.1.0: automated matches [191348] (1 protein)
    not a true family
  6. 2973040Protein automated matches [190280] (10 species)
    not a true protein
  7. 2973055Species Clostridium intestinale [TaxId:36845] [391713] (1 PDB entry)
  8. 2973056Domain d6ssca_: 6ssc A: [391714]
    automated match to d4zxma_
    complexed with gol, po4, zn

Details for d6ssca_

PDB Entry: 6ssc (more details), 1.21 Å

PDB Description: n-acetylmuramoyl-l-alanine amidase lysc from clostridium intestinale urnw
PDB Compounds: (A:) n-acetylmuramoyl-l-alanine amidase

SCOPe Domain Sequences for d6ssca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ssca_ d.118.1.0 (A:) automated matches {Clostridium intestinale [TaxId: 36845]}
tpkivevnytwatplsynfnpnmivyhhtvdnnmtpqkideihkqrgwsgigyhfyirkd
gtiyrgrpenavgshapgvnarafgiasegnfneeyvtpqqmtslialsrylmnkynitd
lkrhkdvrqtecpgnnfpfeeikaklnvk

SCOPe Domain Coordinates for d6ssca_:

Click to download the PDB-style file with coordinates for d6ssca_.
(The format of our PDB-style files is described here.)

Timeline for d6ssca_: