Lineage for d6sv1m_ (6sv1 M:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2318132Species Rhodospirillum rubrum [TaxId:1085] [320959] (5 PDB entries)
  8. 2318145Domain d6sv1m_: 6sv1 M: [391711]
    Other proteins in same PDB: d6sv1a2, d6sv1c2, d6sv1d2, d6sv1e2, d6sv1f2, d6sv1g2, d6sv1i2, d6sv1k2, d6sv1s2, d6sv1t2, d6sv1v2, d6sv1w2, d6sv1x2, d6sv1z2
    automated match to d1zpyg_
    complexed with ca, fe

Details for d6sv1m_

PDB Entry: 6sv1 (more details), 2.19 Å

PDB Description: crystal structure of rhodospirillum rubrum rru_a0973 e34a variant
PDB Compounds: (M:) encapsulated ferritin

SCOPe Domain Sequences for d6sv1m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sv1m_ a.25.1.0 (M:) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
theplevlkeetvnrhraivsvmeelaavdwydqrvdastdpeltailahnrdeekehaa
mtlewlrrndakwaehlrtylftegpit

SCOPe Domain Coordinates for d6sv1m_:

Click to download the PDB-style file with coordinates for d6sv1m_.
(The format of our PDB-style files is described here.)

Timeline for d6sv1m_: