Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein Sex-lethal protein [54938] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [54939] (4 PDB entries) |
Domain d1b7fb1: 1b7f B:123-204 [39171] protein/RNA complex |
PDB Entry: 1b7f (more details), 2.6 Å
SCOPe Domain Sequences for d1b7fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b7fb1 d.58.7.1 (B:123-204) Sex-lethal protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} sntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysygyafvdftsemdsqra ikvlngitvrnkrlkvsyarpg
Timeline for d1b7fb1: