SCOPe 2.08: Domain d1b7fb1: 1b7f B:123-204

Lineage for d1b7fb1 (1b7f B:123-204)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Sex-lethal protein [54938] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [54939] (4 PDB entries)

8. Domain d1b7fb1: 1b7f B:123-204 [39171]
   protein/RNA complex

Details for d1b7fb1

PDB Entry: 1b7f, 2.6 Å

PDB Description: sxl-lethal protein/rna complex

PDB Compounds: (B:) protein (sxl-lethal protein)

SCOPe Domain Sequences for d1b7fb1:

Sequence; same for both SEQRES and ATOM records:

>d1b7fb1 d.58.7.1 (B:123-204) Sex-lethal protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysygyafvdftsemdsqra
ikvlngitvrnkrlkvsyarpg

Timeline for d1b7fb1:

• d1b7fb1 first appeared (with stable ids) in SCOP 1.55
  
• d1b7fb1 appears in SCOPe 2.07