Lineage for d6sxib_ (6sxi B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759637Domain d6sxib_: 6sxi B: [391709]
    Other proteins in same PDB: d6sxia1, d6sxia2, d6sxih_, d6sxil2
    automated match to d2ybrh_
    complexed with gol

Details for d6sxib_

PDB Entry: 6sxi (more details), 1.85 Å

PDB Description: antibody-anti-idiotype complex: ap33 fab (hepatitis c virus e2 antibody) - b2.1a scfv (anti-idiotype)
PDB Compounds: (B:) Single chain Fv - light chain

SCOPe Domain Sequences for d6sxib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sxib_ b.1.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gasdivmtqspkfmstsvgdrvsitckasqnvrtavawyqqkpgqspkaliylassrhtg
vpdrftgsgsgtdftltisnvqsedladyfclqhwnypytfgggtkle

SCOPe Domain Coordinates for d6sxib_:

Click to download the PDB-style file with coordinates for d6sxib_.
(The format of our PDB-style files is described here.)

Timeline for d6sxib_: