Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) |
Family d.58.7.1: Canonical RBD [54929] (12 proteins) |
Protein Sex-lethal protein [54938] (1 species) |
Species Drosophila melanogaster [TaxId:7227] [54939] (4 PDB entries) |
Domain d1b7fa2: 1b7f A:205-289 [39170] |
PDB Entry: 1b7f (more details), 2.6 Å
SCOP Domain Sequences for d1b7fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster} gesikdtnlyvtnlprtitddqldtifgkygsivqknilrdkltgrprgvafvrynkree aqeaisalnnvipeggsqplsvrla
Timeline for d1b7fa2: