SCOPe 2.08: Domain d6swhe_: 6swh E:

Lineage for d6swhe_ (6swh E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.0: automated matches [191391] (1 protein)
   not a true family

6. Protein automated matches [190503] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [346217] (8 PDB entries)

8. Domain d6swhe_: 6swh E: [391695]
   Other proteins in same PDB: d6swha1, d6swha2, d6swhd1, d6swhd2
   automated match to d5lp9a_
   complexed with edo, peg

Details for d6swhe_

PDB Entry: 6swh, 2.8 Å

PDB Description: crystal structure of the ternary complex between the type 1 pilus proteins fimc, fimi and fima from e. coli

PDB Compounds: (E:) Fimbrin-like protein FimI

SCOPe Domain Sequences for d6swhe_:

Sequence, based on SEQRES records:

>d6swhe_ b.2.3.0 (E:) automated matches {Escherichia coli [TaxId: 83333]}
ttlpggnmqfqgviiaetcrieagdkqmtvnmgqissnrfhavgedsapvpfvihlrecs
tvvservgvafhgvadgknpdvlsvgegpgiatnigvalfddegnlvpinrppanwkrly
sgstslhfiakyratgrrvtggianaqawfsltyq

Sequence, based on observed residues (ATOM records):

>d6swhe_ b.2.3.0 (E:) automated matches {Escherichia coli [TaxId: 83333]}
ttlpggnmqfqgviiaetcrieagdkqmtvnmgqissnrfhavgedsapvpfvihlrecs
tvvservgvafhgvadgknpdvlsvgegpgiatnigvalfddegnlvpinrppanwksts
lhfiakyratgrrvtggianaqawfsltyq

Timeline for d6swhe_:

• d6swhe_ first appeared in SCOPe 2.07