Lineage for d6sw8b1 (6sw8 B:2-73)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311085Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2311086Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2311087Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 2311100Protein automated matches [190929] (8 species)
    not a true protein
  7. 2311123Species Influenza a virus (a/turkey/italy/977/1999(h7n1)) [TaxId:437402] [391651] (1 PDB entry)
  8. 2311125Domain d6sw8b1: 6sw8 B:2-73 [391690]
    Other proteins in same PDB: d6sw8a2, d6sw8b2
    automated match to d2n74a_
    complexed with edo, peg

Details for d6sw8b1

PDB Entry: 6sw8 (more details), 1.93 Å

PDB Description: crystal structure of the ns1 (h7n1) rna-binding domain
PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d6sw8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sw8b1 a.16.1.1 (B:2-73) automated matches {Influenza a virus (a/turkey/italy/977/1999(h7n1)) [TaxId: 437402]}
dsntitsfqvdcylwhirkllsmrdmcdapfddrlrrdqkalkgrgstlgldlrvatmeg
kkivedilkset

SCOPe Domain Coordinates for d6sw8b1:

Click to download the PDB-style file with coordinates for d6sw8b1.
(The format of our PDB-style files is described here.)

Timeline for d6sw8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6sw8b2