SCOPe 2.07: Domain d6sw8b1: 6sw8 B:2-73

Lineage for d6sw8b1 (6sw8 B:2-73)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families)

5. Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)

6. Protein automated matches [190929] (8 species)
   not a true protein

7. Species Influenza a virus (a/turkey/italy/977/1999(h7n1)) [TaxId:437402] [391651] (1 PDB entry)

8. Domain d6sw8b1: 6sw8 B:2-73 [391690]
   Other proteins in same PDB: d6sw8a2, d6sw8b2
   automated match to d2n74a_
   complexed with edo, peg

Details for d6sw8b1

PDB Entry: 6sw8, 1.93 Å

PDB Description: crystal structure of the ns1 (h7n1) rna-binding domain

PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d6sw8b1:

Sequence; same for both SEQRES and ATOM records:

>d6sw8b1 a.16.1.1 (B:2-73) automated matches {Influenza a virus (a/turkey/italy/977/1999(h7n1)) [TaxId: 437402]}
dsntitsfqvdcylwhirkllsmrdmcdapfddrlrrdqkalkgrgstlgldlrvatmeg
kkivedilkset

Timeline for d6sw8b1:

• d6sw8b1 is new in SCOPe 2.07-stable
  
• d6sw8b1 appears in the current release, SCOPe 2.08