SCOPe 2.05: Domain d1b7fa1: 1b7f A:123-204

Lineage for d1b7fa1 (1b7f A:123-204)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Sex-lethal protein [54938] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [54939] (4 PDB entries)

8. Domain d1b7fa1: 1b7f A:123-204 [39169]
   protein/RNA complex

Details for d1b7fa1

PDB Entry: 1b7f, 2.6 Å

PDB Description: sxl-lethal protein/rna complex

PDB Compounds: (A:) protein (sxl-lethal protein)

SCOPe Domain Sequences for d1b7fa1:

Sequence; same for both SEQRES and ATOM records:

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysygyafvdftsemdsqra
ikvlngitvrnkrlkvsyarpg

Timeline for d1b7fa1:

• d1b7fa1 first appeared (with stable ids) in SCOP 1.55
  
• d1b7fa1 appears in SCOPe 2.04
  
• d1b7fa1 appears in SCOPe 2.06
  
• d1b7fa1 appears in the current release, SCOPe 2.08