SCOP 1.65: Domain d1b7fa1: 1b7f A:123-204

Lineage for d1b7fa1 (1b7f A:123-204)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families)

5. Family d.58.7.1: Canonical RBD [54929] (16 proteins)

6. Protein Sex-lethal protein [54938] (1 species)

7. Species Drosophila melanogaster [TaxId:7227] [54939] (4 PDB entries)

8. Domain d1b7fa1: 1b7f A:123-204 [39169]

Details for d1b7fa1

PDB Entry: 1b7f, 2.6 Å

PDB Description: sxl-lethal protein/rna complex

SCOP Domain Sequences for d1b7fa1:

Sequence; same for both SEQRES and ATOM records:

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster}
sntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysygyafvdftsemdsqra
ikvlngitvrnkrlkvsyarpg

Timeline for d1b7fa1:

• d1b7fa1 first appeared (with stable ids) in SCOP 1.55
  
• d1b7fa1 appears in SCOP 1.63
  
• d1b7fa1 appears in SCOP 1.67
  
• d1b7fa1 appears in the current release, SCOPe 2.08