Lineage for d6swxa2 (6swx A:575-736)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319167Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2319168Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2319221Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2319222Protein automated matches [226872] (13 species)
    not a true protein
  7. 2319244Species Leishmania major [TaxId:5664] [267847] (2 PDB entries)
  8. 2319246Domain d6swxa2: 6swx A:575-736 [391686]
    Other proteins in same PDB: d6swxa1, d6swxa3
    automated match to d3kfla2
    protein/RNA complex; complexed with lwn, met

Details for d6swxa2

PDB Entry: 6swx (more details), 1.95 Å

PDB Description: leishmania major methionyl-trna synthetase in complex with an allosteric inhibitor
PDB Compounds: (A:) Putative methionyl-tRNA synthetase

SCOPe Domain Sequences for d6swxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6swxa2 a.27.1.0 (A:575-736) automated matches {Leishmania major [TaxId: 5664]}
adtlgnlvsrcvapkinvngmwpepaeysesdktliaslnnlagtvdhyyclpdiqhali
aifdvlrslnayvtenapwklvkmdtarlgtvlyvtmeglrictmflqpvmpqkakeimd
algvpeaarvgmenylfgivkpgtkiaglaegqvvfqkvtlp

SCOPe Domain Coordinates for d6swxa2:

Click to download the PDB-style file with coordinates for d6swxa2.
(The format of our PDB-style files is described here.)

Timeline for d6swxa2: