Lineage for d6swxa1 (6swx A:206-574)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469237Species Leishmania major [TaxId:5664] [267846] (2 PDB entries)
  8. 2469239Domain d6swxa1: 6swx A:206-574 [391685]
    Other proteins in same PDB: d6swxa2, d6swxa3
    automated match to d3kfla1
    protein/RNA complex; complexed with lwn, met

Details for d6swxa1

PDB Entry: 6swx (more details), 1.95 Å

PDB Description: leishmania major methionyl-trna synthetase in complex with an allosteric inhibitor
PDB Compounds: (A:) Putative methionyl-tRNA synthetase

SCOPe Domain Sequences for d6swxa1:

Sequence, based on SEQRES records: (download)

>d6swxa1 c.26.1.0 (A:206-574) automated matches {Leishmania major [TaxId: 5664]}
kkqkvffattpiyyvnasphighvystlivdvlgryhrvkgeevfvmtgtdehgqkvaea
aakqgvspmdfttsvssefkqcfqemnydmnyfirttnptheklvqdiwkklaakgdiyl
gkyegwysvsdesfltaqnvadgvdrdgkpckvslesghvvtwveeenymfrlsafrerl
lkyfhdhpncivpefrrreviktvekglfdlsisrkresvmnwsipvpgderhciyvwld
alfnyytgaltrvatdgtetldedhhalnrwpadvhvvgkdilkfhaiywpaflmsaelp
lperlvshgwwtkdhkkiskslgnafdpvekakefgidalkyflmresnfqddgdysdkn
mvarlngel

Sequence, based on observed residues (ATOM records): (download)

>d6swxa1 c.26.1.0 (A:206-574) automated matches {Leishmania major [TaxId: 5664]}
kkqkvffattpiyyvnasphighvystlivdvlgryhrvkgeevfvmtgtdehgqkvaea
aakqgvspmdfttsvssefkqcfqemnydmnyfirttnptheklvqdiwkklaakgdiyl
gkyegwysvsdesfltaqnvadgvdrdgkpckvslesghvvtwveeenymfrlsafrerl
lkyfhdhpncivpefrrreviktvekglfdlsisrkresvmnwsipvpgderhciyvwld
alfnyytgaltrvatdgtetldedhhalnrwpadvhvvgkdilkfhaiywpaflmsaelp
lperlvshgwwtkdhkkisksnafdpvekakefgidalkyflmresnfqddgdysdknmv
arlngel

SCOPe Domain Coordinates for d6swxa1:

Click to download the PDB-style file with coordinates for d6swxa1.
(The format of our PDB-style files is described here.)

Timeline for d6swxa1: