Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) |
Family d.58.7.1: Canonical RBD [54929] (16 proteins) |
Protein Splicing factor U2AF 65 KDa subunit [54936] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54937] (3 PDB entries) |
Domain d1u2fa_: 1u2f A: [39168] first RNA-binding domain |
PDB Entry: 1u2f (more details)
SCOP Domain Sequences for d1u2fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens)} arrlyvgnipfgiteeammdffnaqmrlggltqapgnpvlavqinqdknfaflefrsvde ttqamafdgiifqgqslkirrphdyqplpg
Timeline for d1u2fa_: