Lineage for d1u2fa_ (1u2f A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329138Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 329139Family d.58.7.1: Canonical RBD [54929] (16 proteins)
  6. 329258Protein Splicing factor U2AF 65 KDa subunit [54936] (1 species)
  7. 329259Species Human (Homo sapiens) [TaxId:9606] [54937] (3 PDB entries)
  8. 329262Domain d1u2fa_: 1u2f A: [39168]
    first RNA-binding domain

Details for d1u2fa_

PDB Entry: 1u2f (more details)

PDB Description: solution structure of the first rna-binding domain of hu2af65

SCOP Domain Sequences for d1u2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens)}
arrlyvgnipfgiteeammdffnaqmrlggltqapgnpvlavqinqdknfaflefrsvde
ttqamafdgiifqgqslkirrphdyqplpg

SCOP Domain Coordinates for d1u2fa_:

Click to download the PDB-style file with coordinates for d1u2fa_.
(The format of our PDB-style files is described here.)

Timeline for d1u2fa_: