![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (12 proteins) |
![]() | Protein Splicing factor U2AF 65 KDa subunit [54936] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54937] (2 PDB entries) |
![]() | Domain d1u2fa_: 1u2f A: [39168] |
PDB Entry: 1u2f (more details)
SCOP Domain Sequences for d1u2fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens)} arrlyvgnipfgiteeammdffnaqmrlggltqapgnpvlavqinqdknfaflefrsvde ttqamafdgiifqgqslkirrphdyqplpg
Timeline for d1u2fa_: