Lineage for d6suwh_ (6suw H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2318263Species Rhodospirillum rubrum [TaxId:269796] [335612] (2 PDB entries)
  8. 2318271Domain d6suwh_: 6suw H: [391679]
    Other proteins in same PDB: d6suwa2, d6suwk2, d6suwl2, d6suws2
    automated match to d1zpyg_
    complexed with ca, fe

Details for d6suwh_

PDB Entry: 6suw (more details), 2.66 Å

PDB Description: crystal structure of rhodospirillum rubrum rru_a0973 e31a variant
PDB Compounds: (H:) Uncharacterized protein

SCOPe Domain Sequences for d6suwh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6suwh_ a.25.1.0 (H:) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
stheplevlkeetvnrhraivsvmaeleavdwydqrvdastdpeltailahnrdeekeha
amtlewlrrndakwaehlrtylftegpita

SCOPe Domain Coordinates for d6suwh_:

Click to download the PDB-style file with coordinates for d6suwh_.
(The format of our PDB-style files is described here.)

Timeline for d6suwh_: